PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG037381t1
Common NameTCM_037381
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family Trihelix
Protein Properties Length: 594aa    MW: 67315.9 Da    PI: 6.8863
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG037381t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix100.21.7e-31422506186
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                       rW++ ev aLi++rr+ e+++r+  lk+plWeevs++m++ g++rs+k+Ckekwen+nk+++k ke+ k r s++s+tc yfdql+
  Thecc1EG037381t1 422 RWPRAEVEALIQVRRNFESKFREPGLKGPLWEEVSSFMASLGYQRSAKRCKEKWENINKYFRKSKENGKMR-SQQSKTCTYFDQLD 506
                       8*****************************************************************99997.88889********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.189419479IPR017877Myb-like domain
SMARTSM007170.0067419481IPR001005SANT/Myb domain
PfamPF138376.3E-21421508No hitNo description
CDDcd122033.11E-28421486No hitNo description
Gene3DG3DSA:1.10.10.609.5E-4421478IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MHPVKYGAHH LEQQQLMDDD GSSSAVFSIS NPPQYHHQQS PFHPNYPQHS QQQQKQQQNL  60
FQQLSSVPVT HQLFQHQQFQ PFEQQAEPAH HHVHQQPFLA VNFKLGLNEN SGKKEAALAL  120
NHQPNDATFF DGNEQHVHGN RRPQQHSLLM PHCWHPQEDS PIKEPFWKPL NRCEDRQCSG  180
DGAREMEGNK YNKVLQPPGQ CPSERSKNLD NKYRLFGELE AIYGLAKGGE TTQAGSGSAL  240
TGENSPTNVG LSMPLSEFQG HNVGANCGGG NVAHGVDHGS ETSIGEEASI RKIEKKKRKR  300
KMKEQLSSMI GFFECLVKQV TDHQEGLHKR FLEVIERMDK ERTGKEESWR RQEAEKRNRE  360
AFARAHEQAL ATSREALIVS YLEKITGQSV SLPARTPLLL QPESAIEPFK ESMPVKVDNS  420
SRWPRAEVEA LIQVRRNFES KFREPGLKGP LWEEVSSFMA SLGYQRSAKR CKEKWENINK  480
YFRKSKENGK MRSQQSKTCT YFDQLDQLYS RIPVTCPTSP RPLINKDIEM QEHGDSDFLE  540
AYMPEGDLGT AQDNASGSHK VSEINSQLDF DGAVDENVVV QGCNGKDNEI HEN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1294300KKKRKRK
2294301KKKRKRKM
3295300KKRKRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007012413.10.0Duplicated homeodomain-like superfamily protein, putative
TrEMBLA0A061GLL20.0A0A061GLL2_THECC; Duplicated homeodomain-like superfamily protein, putative
STRINGPOPTR_0018s05520.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.21e-51Trihelix family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]